PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00026537001
Common NameGSBRNA2T00026537001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family Dof
Protein Properties Length: 283aa    MW: 32281 Da    PI: 9.4129
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00026537001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof40.36.7e-132112403261
               zf-Dof  32 fCkaCrryWtkGGalrnvPvGggrrknkks 61 
                           Ck+C+ryWt+GG +r v vG+gr knk+ 
  GSBRNA2T00026537001 211 VCKKCQRYWTAGGKMRYVLVGAGRHKNKNL 240
                          6**************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF476612.75E-562167IPR010989t-SNARE
PfamPF145235.4E-769162No hitNo description
PfamPF027019.0E-9211239IPR003851Zinc finger, Dof-type
ProDomPD0074781.0E-6212238IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016192Biological Processvesicle-mediated transport
GO:0016020Cellular Componentmembrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 283 aa     Download sequence    Send to blast
MWAYICCRDL CPAYYNQADE EEIHVFRNAS FKSLGLCRLL QYEIYSQTMV SRAVFHILLN  60
TPKNFQLQIH LINVLLKSIT HLRSTFNASF TQARRWNCDY KKEKEKVTDI RTGAAKLKED  120
SEADFHGAAT NIVNAKLAKD FQSVLKEFQK AQRLAAEREI RYTHVVTKDI PTRVVIEWYL  180
LSRGEAKGTG ENYALPAIQQ YGDQALLLQL VCKKCQRYWT AGGKMRYVLV GAGRHKNKNL  240
ASHNNCNVSI TSAETDLQHP YGTNLLHILA LIQSSANQWH QG*
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00026537001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2373346e-44AC237334.1 Arabidopsis lyrata clone JGIFAFI-61P18, complete sequence.
GenBankAF4117976e-44AF411797.1 Arabidopsis thaliana AT5g16830/F5E19_170 mRNA, complete cds.
GenBankAL3911476e-44AL391147.1 Arabidopsis thaliana DNA chromosome 5, BAC clone F5E19 (ESSA project).
GenBankATHSYNTAXH6e-44L41651.1 Arabidopsis thaliana syntaxin of plants 21 (SYP21) mRNA, complete cds.
GenBankAY0885996e-44AY088599.1 Arabidopsis thaliana clone 8257 mRNA, complete sequence.
GenBankBT0250366e-44BT025036.1 Arabidopsis thaliana At5g16830 mRNA, complete cds.
GenBankCP0026886e-44CP002688.1 Arabidopsis thaliana chromosome 5 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A078GG670.0A0A078GG67_BRANA; BnaA07g02590D protein
TrEMBLM4CCX60.0M4CCX6_BRARP; Uncharacterized protein
STRINGBra002057.1-P0.0(Brassica rapa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39660.22e-20cycling DOF factor 2
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]